SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262195496|ref|YP_003266705.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262195496|ref|YP_003266705.1|
Domain Number 1 Region: 136-384
Classification Level Classification E-value
Superfamily Subtilisin-like 2.49e-70
Family Subtilases 0.00000443
Further Details:      
 
Domain Number 2 Region: 50-120
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.0000000000153
Family Subtilase propeptides/inhibitors 0.0028
Further Details:      
 
Domain Number 3 Region: 426-461
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000114
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|262195496|ref|YP_003266705.1|
Sequence length 461
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MQARNLFRLMAVGILGGSFATGCAAVEEDFAESVATTTAPLLGDASTAIEGEYIVKFKDD
VAAKGVGIAMNRVSLASANSRIMREYKTFPGFAAKLDKRDLQNLQKNPDVEYLEFNGRME
ALKIENVQADGIDRIDQRSGRNGQYNDSDLTASGVTAYIVDTGIRSTHNEFTGRVAGTID
FVGDGQTEDCNGHGSHVASTVAGTQFGVADGAQIYGVRVLNCSGSGSFAGVISGIDFVAQ
DCSGDCVANMSLGGGFSQAVNDAVEAAVAAGIPFAVASGNSNADSCGFSPASAPSAITVD
AAADNDSRASFSNFGSCSDLYAPGVSILGADIGSDSDTQSISGTSMASPHVAGVMAQILD
CNPGATPAEVEAILKAAATSGAISNPNGTANLLLFTGAELCDELPDPDPDPDPDPEPDPD
PEPDPASCEGRCGSFDSGAVCQCDRFCQFFGDCCSDYFNEC
Download sequence
Identical sequences D0LHY3
502025.Hoch_2269 gi|262195496|ref|YP_003266705.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]