SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262196128|ref|YP_003267337.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262196128|ref|YP_003267337.1|
Domain Number 1 Region: 263-299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 159-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 3 Region: 195-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 122-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000254
Family LDL receptor-like module 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|262196128|ref|YP_003267337.1|
Domain Number - Region: 229-260
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000113
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262196128|ref|YP_003267337.1|
Sequence length 301
Comment Low density lipoprotein-receptor, class A, cysteine-rich [Haliangium ochraceum DSM 14365]
Sequence
MTGMLRSRIAEQWGRSASRVWLVRCGGAWLACALLAVSACGGGGDGDGGGDGGGQEGPLY
DELRACDVLTSGYFAGRVQVRDEIRACYEQCLLELSCDELREGFCDPLSEPGEACERECD
PRFACADGGEAYERERCDGLWQCQDGSDEDGCESVMPPPEVFLCESGMGESSPQSAVCDG
RAECADGSDEQDCEYFYCDDGAPVHVDAVCDRVSDCFDNSDESGCPEPEPYLCEDGFPLT
ADDVCDGNPECQYGEDELDCPGEDSFRCGDGRDIPLKMRCDLQDDCDDGSDEDGCARLSC
L
Download sequence
Identical sequences D0LPT1
gi|262196128|ref|YP_003267337.1| 502025.Hoch_2927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]