SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262196353|ref|YP_003267562.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262196353|ref|YP_003267562.1|
Domain Number 1 Region: 929-1207
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.71e-42
Family Complement components 0.0014
Further Details:      
 
Domain Number 2 Region: 1314-1399
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.000049
Family Alpha-macroglobulin receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262196353|ref|YP_003267562.1|
Sequence length 1411
Comment A-macroglobulin complement component [Haliangium ochraceum DSM 14365]
Sequence
MQRTSKRSLPLRSLALCLSLGALSCGARSAAVESGGEGGAGDPVQIVEPGTVPAPSALQN
QLAAQDPARPQMPSDDQKRLGAAIDTYMQRHASQRLYMHVDKPLYRPGETIWFRVWELAA
PTLTKQEQNHGVSVDLVSPRGSQVLSKRVLAQAGVAAFDFELPASVEGGVYILRARSDLG
ATLEREVVVSQYQPPRIKKKVEFLRKAYGAGDEVAAAVSLARATGEPLVTDKATAIVTVD
EIEVARFPVQTSEDGEAVARFTLPPQIARGDGLLTLLVDDGGAVESMQKRIPILVKSLDL
QLFPEGGQLVSGLPGRVYFQAKNPLGKPADIAGRVLDDRGQVVAQFSSLHNGMGRFELTP
AKGRIYHVEVTSPRGIEAPFTVPPARPDGCSLMAVDDPEGQRDEVRVAAWCSSPRTAVVT
GILREKRLADVAVEVGAEAPTVVAIPVPPGAQGAMRVTLFDEHLKPVAERLVYTGRGRDM
QVSISTDRPSYAPRDRVALTVTTRDLRGKPVAADVSLAVVDDTVLSFADDKSAAILARVY
LEAEMPGQEIEEPRFYFSEDPKAGPALDLVLGTQGWRRFVWQELFAEARGGGSRSSVVGG
ALAVPEADMAMDEEMEALDDAMPMPPPPPAPVAAQAAPGANEAMAAKPEAPAEPAPELER
AEAPRRLAGGFGRGLRARRARPMEKKRMMAADEDEWGGEVRGWAVVREFPAPNYEPGYSG
PRVDFRETIYWQPSVQTGADGTAEVSFSLSDAVTSFRATAEGVSGGGLPGRGEALVQSKL
PVSLAVTMPLEVSAGDSLELPVVLTNETERPQSARITSEFGAAFRVRGGVPKQVRLEPGE
RQSFFAQLEVVGNGKDPEAGSARIAMDTANLSDEVARTIRVVPLGFPQELAASGTLDQRA
THSFELAGAMPGSIEATITMYPSPLATMVQGTEALIREPGGCFEQASSSNYPNVMVLSYL
EKNDAADVALVERTMGALDRGYALLTGYESKSKGYEWFGGDPGHEALTAYGLLEFVDMAQ
VYGDVDPQMVQRTRRWLMSRRDGEGGFLRNDRALDSFGRASVEVTNGYITYALTAAGEKA
LDKEIAYQQRMAKETKDPYLMALAAGTLVHVKAAEAQSAVTRLRSMQAEDGSFAGADHSI
TRSGGEALIIETTALAAKAMIDLGLAGDADTRAAIEWLNAHRGGYGQFSSTQATILALRA
LSAYAEASRATQSSGVATLLVNGKQAGTLRFEAGHKDALVWEDVARLLHSGKNTLELRLD
SEQSLPYSIGISYRSKMPASNPETVVRVATSLSKDEVPVGEGVRMKVTVDNTTDEGQPMT
LARVGIPGGLAFQTWQLEELKDKGVIGFFETREREVVLYFRDLAPKAHKEIDIDLLARVP
GSYVAPASRAYLYYTDEFKHWVPPTEVRVTR
Download sequence
Identical sequences D0LSH0
502025.Hoch_3167 gi|262196353|ref|YP_003267562.1| WP_012828269.1.83622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]