SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262197935|ref|YP_003269144.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262197935|ref|YP_003269144.1|
Domain Number 1 Region: 145-332
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 5.53e-40
Family Endonuclease I 0.0007
Further Details:      
 
Domain Number 2 Region: 74-110
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000222
Family Somatomedin B domain 0.0034
Further Details:      
 
Domain Number 3 Region: 34-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000183
Family Somatomedin B domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262197935|ref|YP_003269144.1|
Sequence length 341
Comment endonuclease I [Haliangium ochraceum DSM 14365]
Sequence
MMSVLVGCSEAELVRGSDKAVDVAIAGSCEVTDCGGQSADGCYCDDACTNFGDCCDDYDA
VCVNPQPEPDPVGGTCQGFCGGQADGCWCNSSCTSYGDCCDDYEAVCLGEPDPDPEPDPD
PDPGTDPWAGLSNGALIDALETETKSGHSGLGYTTARNYMYGITGSGIDVHGGIVEGVYT
GELANADGTRTPGGELNTEHTWPQSKGAGSEPAKSDMHHLFPAEMTANSQRSSHPFGETS
CTASACPWSDGGSERGTDSSGTTVFQVRSAHRGNTARAMFYFSVRYGLSIDSSQEATLKA
WNDQDPVDAAERERNDAVEAAQGNRNPFIDYPHLSDRISNF
Download sequence
Identical sequences D0LSM9
502025.Hoch_4761 WP_012829849.1.83622 gi|262197935|ref|YP_003269144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]