SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262199416|ref|YP_003270625.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262199416|ref|YP_003270625.1|
Domain Number 1 Region: 121-369
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-73
Family Subtilases 0.00000477
Further Details:      
 
Domain Number 2 Region: 39-109
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000000623
Family Subtilase propeptides/inhibitors 0.0032
Further Details:      
 
Weak hits

Sequence:  gi|262199416|ref|YP_003270625.1|
Domain Number - Region: 393-424
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00628
Family Somatomedin B domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262199416|ref|YP_003270625.1|
Sequence length 427
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MLFAGQSMIAGCAMPDDAQPLTTGTTVAPLLGEGIEAIPDEYIVVMKSEIGARDVHATID
SLQLSKSASVLHEYSVFPGFAAHLSGKDLAQVRSDERVAYVERNGVVRLNKIEAVAADGI
DRIDQRNLPRDGFYNDRDRDGSGVDIYIIDTGIRSTHSEFTGRVGTLRDFVGDGRVEDCQ
GHGTHVASTAAGTQYGVADHATVHGIRVLSCSGSGTFAGVIAGINFVAQDCNGDCVANMS
LGGGFSQAVNDAVTSAVNSGISFALAAGNENTNACNRSPASTPAAITVGAVDDNDNRASF
SNFGNCVDLFAPGVSILGASIANDNATATLSGTSMASPHVAGVMAQILDCNPGATPAQVE
QILETAATPGIIGNPNGAPNLMLYNEVCSSNPNSCAQSNSCGGQAPGGCFCDPFCSAFGD
CCPDGPC
Download sequence
Identical sequences D0LMP5
502025.Hoch_6261 gi|262199416|ref|YP_003270625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]