SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262199860|ref|YP_003271069.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262199860|ref|YP_003271069.1|
Domain Number 1 Region: 166-398
Classification Level Classification E-value
Superfamily Subtilisin-like 7.59e-35
Family Subtilases 0.0000463
Further Details:      
 
Domain Number 2 Region: 62-132
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000017
Family Subtilase propeptides/inhibitors 0.0043
Further Details:      
 
Domain Number 3 Region: 427-463
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000275
Family Somatomedin B domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|262199860|ref|YP_003271069.1|
Sequence length 495
Comment peptidase S8/S53 subtilisin kexin sedolisin [Haliangium ochraceum DSM 14365]
Sequence
MTIRNDKRTAGIGLSAVFVSVLAFGLGTGCSTAELELAEAEQTLSTQLAPLYGDAVAETI
ADRYIVVFDDAQGAGEVSALAAELALTQPKSRIEHTLTVLPAAIATLAPEDLDAVRRHPG
VAYVERDQVLRAAWKPEPGPAGEGEGVGVDDGEYRPDTTYPLPGGQPIGIDRVDQPSLPR
DGVYDDHGCDGGGTRVYVIDTGVRSSHTEFHGRVDTARGFTAIADGNGTEDCLGTGTHVA
STAAGRRYGMAKQASVVPVRVMSCSGSGSNAGVIAGVNHVAADCAPGDACVAVMTLGGGA
SLALDTAVNNLVASGVPVAVSAGSGSCTGSPATAAAATTVAAVGSDDCSNISGSCVDIYA
PATSILGASASSDTASAVFSGMSAPAHAAGAMAQALSCGLPGAPAVTDATCTSTGAVLPL
VYNDFSGSCVGRCGDLDTTEVCQCDAGCSARGDCCADIADECPCNAANACGGAAAGCYCD
SVCTVYGDCCSDGPC
Download sequence
Identical sequences D0LT40
gi|262199860|ref|YP_003271069.1| 502025.Hoch_6712 WP_012831768.1.83622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]