SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|262197152|ref|YP_003268361.1| from Haliangium ochraceum DSM 14365

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|262197152|ref|YP_003268361.1|
Domain Number 1 Region: 48-145
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000000981
Family Collagen-binding domain 0.0096
Further Details:      
 
Weak hits

Sequence:  gi|262197152|ref|YP_003268361.1|
Domain Number - Region: 179-247
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0471
Family Collagen-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|262197152|ref|YP_003268361.1|
Sequence length 470
Comment peptidase domain-containing protein [Haliangium ochraceum DSM 14365]
Sequence
MCGLGACLSLLALGACDKRTGTAKHIPRDDDALPVVVVDEVASATATIDEVEPNNERAQA
TEVALGEAGKGVLDGEEDVDFYRVAVASADVLSVRLSGIEAVDLMLELQDQGGEVLARSD
RGPAGTLEGIANFYVEPGSYFLAVREFVPKRRKRKGEPRTGPSPAYTLELARLSEIAETQ
EREPNQDVEGARELLVGDEGSGFIGWGGDVDLWKLPVEGFTEQYSLDLDLTGVPAATLTL
ELLDSGGSVILKRTGAADSALAVRNLVPESAGDDATGPTQHTYYARISARRSNPVDPYLL
RVSSHLLDLSDEREPNDVAAQASSLLGVDPGQTADSRSGRVTGTLTVGDTDVFSLPAQGE
AVALTVELVPREDLDATLTVLSNGETRAMANANGKGGKEYLADVRIDAGASAVVQISGEG
ALGEGAGYLLNWSLATAFEPPQDTLDSTWGELPPELGGDAAGSGDDFRGD
Download sequence
Identical sequences D0LI89
WP_012829067.1.83622 502025.Hoch_3969 gi|262197152|ref|YP_003268361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]