SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292494058|ref|YP_003533200.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292494058|ref|YP_003533200.1|
Domain Number 1 Region: 59-137
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000143
Family Bacterial exopeptidase dimerisation domain 0.0062
Further Details:      
 
Domain Number 2 Region: 6-88,141-170,218-281
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000000000154
Family Bacterial dinuclear zinc exopeptidases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292494058|ref|YP_003533200.1|
Sequence length 315
Comment hypothetical protein HVO_B0120 [Haloferax volcanii DS2]
Sequence
MNHNETFETVESLEAELVSLTESLWEQPELGLHETESAELLSSVLRDGAFDDLDAVELLN
TGSEFMREHVSDDARIHYTIPDGGGAPNVVPAEATAWFYVRAPTRDEVDRITDWLDDVAE
GAALMTQTTVSRRFHTGCYDYVANHALSDALLENMRLAGPIPYTDEDREFAAELQETLSA
ETIEARTAQLPEERREAARSSVLYPDAQPSYDVGTVLNGSTDVGDVSWITPTAQFWAASW
PVGTPSHTWQAVATNGSFGSKAAVYAAKVLAATTLDLFSDEALVAAAREEFEASVPGDYE
CALPEGTEPPFHLTL
Download sequence
Identical sequences D4GPC1 L9VKA6
WP_004041036.1.66890 WP_004041036.1.84848 gi|292494058|ref|YP_003533200.1| gi|292494058|ref|YP_003533200.1|NC_013964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]