SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292653899|ref|YP_003533797.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292653899|ref|YP_003533797.1|
Domain Number 1 Region: 2-224,340-413
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.66e-74
Family Bacterial dinuclear zinc exopeptidases 0.00024
Further Details:      
 
Domain Number 2 Region: 214-333
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 8.02e-20
Family Bacterial exopeptidase dimerisation domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292653899|ref|YP_003533797.1|
Sequence length 415
Comment N-carbamyol-L-amino acid amidohydrolase [Haloferax volcanii DS2]
Sequence
MRVNQQRLRSDIESNAEFGAVPTDEGRGRTVLTGSEADRRAREFFCERLRDAGLSITIDE
VGNIVGRWEPESADPDAAPVATGSHLDSVPEGGIFDGPLGVYAGLESVRAMQDAGVEPVR
PVEVVNFTEEEGQRFGGGLIGSAVAVGELGVAEALDIEDDDGIPLGDALADIGYRGDGRV
DAADWDAWIELHIEQSERLEDAAVPAGVVTSIVGLSRCAVEITGEADHAGSTLMGDRSDA
LAAASEFVLDVERATNERGEVSETAVGTVGKLEVSPNAPNVIAGQVDLTVDIRDVAYDSI
EYVIDEAEASLDRIEAERPVGAALSHPWDRKPVEMSERCRAALHDAGTDADLDTLDLHSG
AGHDTMHVAAVTDAALLFAPSRDGISHNPREWTDWEDCADATRVLAGALADLATE
Download sequence
Identical sequences D4GR18 L9V522
gi|292653899|ref|YP_003533797.1|NC_013966 WP_004043253.1.66890 WP_004043253.1.84848 gi|292653899|ref|YP_003533797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]