SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292654219|ref|YP_003534116.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654219|ref|YP_003534116.1|
Domain Number 1 Region: 49-200,290-380
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.71e-44
Family Bacterial dinuclear zinc exopeptidases 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|292654219|ref|YP_003534116.1|
Domain Number - Region: 199-281
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.000698
Family Bacterial exopeptidase dimerisation domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292654219|ref|YP_003534116.1|
Sequence length 381
Comment glutamate carboxypeptidase [Haloferax volcanii DS2]
Sequence
MNAEIDREGHDESETEAESAAETAADTEVDADADTDALDEGEWVDARHLLYDMVSTPSVS
GDEEAAAEVLKAFFEAHDREVWIDEVGNVRAPADDAVLLTSHVDTVPGDVPVKVEDGVLW
GRGSVDATGPLCTMAAAAVETGVSFVGVVGEETSSRGAWHLVEDREEPDAVVNGEPSGWD
GVTLGYRGFLSGTYISTSELGHSSRPEENAIQSAVAWWSRVADFFDEDRDGVFDTVTTKP
VTFDGGPTEDGLAVEATVDVQFRVPPRLSIDDVREVAESELTRGGVHWNKPIPPVMMSPR
TDVARAFRVAIRNVGGVKPRLLRKTGTSDMNIFAGTWDCPMATYGPGDSDLDHAPNEHLD
LAEFDSAIDVLVDVCERLADD
Download sequence
Identical sequences D4GYN7 L9UH14
WP_004045045.1.66890 WP_004045045.1.84848 gi|292654219|ref|YP_003534116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]