SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292654596|ref|YP_003534493.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654596|ref|YP_003534493.1|
Domain Number 1 Region: 2-170,282-364
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.29e-44
Family Bacterial dinuclear zinc exopeptidases 0.0032
Further Details:      
 
Domain Number 2 Region: 170-262
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000000000224
Family Bacterial exopeptidase dimerisation domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292654596|ref|YP_003534493.1|
Sequence length 364
Comment acetylornithine deacetylase [Haloferax volcanii DS2]
Sequence
MDELRDLTETLVSVPSHEDETAAGDAIEAWLREETDADVARDDAGNVVARVNPGVGESLA
LVGHHDVVPPADRQTTDSGDYVVETRDGRLYGRGAADMKGAVAASMLAFRDAAADADSEV
AFASFVGEEIGGEGVRAALDDGFELDYAVVAEGSTNYSGPNRTDVAVAHRGRRASTLVAS
GTACHASGPERGENAVYRATDAVDVVRGLSVPDAEVLDHPVSGSIAVTEIDGGSAWNVIP
DRCEVTLDERTVPGGFADLARTAELEGVEWVVEQDLPPMACDDADFAERVLDAARSVHEA
RSDAEPEQTTKPHATDAGWLAQAGTTCVVYGPSEPGEAHTKDESVSLDVLARCYETYRAL
VANW
Download sequence
Identical sequences D4GRW0 L9UNJ9
gi|292654596|ref|YP_003534493.1| WP_004044505.1.66890 WP_004044505.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]