SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292654645|ref|YP_003534542.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654645|ref|YP_003534542.1|
Domain Number 1 Region: 19-308
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.73e-40
Family Pancreatic carboxypeptidases 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292654645|ref|YP_003534542.1|
Sequence length 318
Comment putative deacylase [Haloferax volcanii DS2]
Sequence
MITLGTASAAPGEMDVGRLEVGESRDGGSVGLPVAVINGASSGKTLYMQAASDGDELNGV
GVIQRVVPQLDPADISGAILVVGIVNYHAFQVAQHRNPIDDTKMNRAYPGDERGTSSERI
AAATFAAARDADLIVDLHQGSTSRMIDEVRVRCGRHHRMHAKCLRLAKTFGCGYVLDQKG
PDGQLARAGPDAGIPTIDPELGGCVGWDEESIEKGVRGVHNVLRGYDFLDGDVELKAQTR
ARGFDQYGSPVGGLVRFKRDLGERVSAGDVVFEVADVFGTLKARVTADHNGIFWRARRLP
QVASGEYVCSVGIDLDTY
Download sequence
Identical sequences D4GS09 L9UM41
gi|292654645|ref|YP_003534542.1| WP_004044453.1.66890 WP_004044453.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]