SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292654839|ref|YP_003534736.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654839|ref|YP_003534736.1|
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000531
Family GHMP Kinase, N-terminal domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292654839|ref|YP_003534736.1|
Sequence length 277
Comment hypothetical protein HVO_0675 [Haloferax volcanii DS2]
Sequence
MSDDATAFVPGHVTGFFSAHPDDDPAVAGSRGAGLTLSHGVSVTVEPAPVTAITLDGEAV
EMPPVVGVLRALGVTAAVDAESELPLGAGFGVSGAMALGTALAANAVFACGRSENELITL
AHVAEVRAGTGLGDVVAQARGGMPLRIDPGAPRHGYMDGIPARPHIEYVTFGGLSTADII
GGDTSTLTAAGEAALDALAEEPTVERFLAESRQFARDAGLLTDRVETAIADVRDAGGDAA
MAMLGETVFAVGTGLSDAGYDTERCRIHPAGSTLDSA
Download sequence
Identical sequences D4GT07 L9UNH3
WP_004044260.1.66890 WP_004044260.1.84848 gi|292654839|ref|YP_003534736.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]