SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292654851|ref|YP_003534748.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654851|ref|YP_003534748.1|
Domain Number 1 Region: 12-218,319-408
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-46
Family Bacterial dinuclear zinc exopeptidases 0.0005
Further Details:      
 
Domain Number 2 Region: 203-318
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.49e-19
Family Bacterial exopeptidase dimerisation domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292654851|ref|YP_003534748.1|
Sequence length 444
Comment AmiB [Haloferax volcanii DS2]
Sequence
MTDDRVAALKARVCDAIDDRADEIIDFAKDVQAEPELGYKEVKTTEKVVSLFEDLDLDVE
TELAITGARARAGSGDFVAAVLGELDALVNPDHPMADPETGAVHACGHNAQLANLVGTAF
GLVGSGVVDDLDGAVEFVAVPAEEYLDLDYRRGLLDAGDIEFFGGKQELIRRGYVDDWDA
AAMMHAGSDTPERTITSDFSTNGFVGKFVTYRGTEAHAGAAPEEGVNALNAAMLGMNAVH
AQRERFRDEDHVRVHPIITRGGDGVNVVPAEVTMESYVRAASVEAVADANESVNRALASG
AMGVGGDVEIEDYPGYMPLRTDETIVAFYDENARDIVGPDAVTPGTPHLSGSTDMGDITQ
LVPGIHPWTGGFEGAVHARDFRVVDEEMAYVIPAKLTACTLVDLLTSPEAMAAVREAKAE
KRSREEYLDAVRSLRATTTESYRD
Download sequence
Identical sequences D4GT26 L9UQK1
WP_004044248.1.66890 WP_004044248.1.84848 gi|292654851|ref|YP_003534748.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]