SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292654989|ref|YP_003534886.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292654989|ref|YP_003534886.1|
Domain Number 1 Region: 6-79,166-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.76e-59
Family Bacterial dinuclear zinc exopeptidases 0.0000099
Further Details:      
 
Domain Number 2 Region: 69-174
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.21e-23
Family Aminopeptidase/glucanase lid domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292654989|ref|YP_003534886.1|
Sequence length 348
Comment TET aminopeptidase-like protein [Haloferax volcanii DS2]
Sequence
MEFDFDRLKQLTETSGVPGYEDRIRALVREDLEATTDSVRVDGMGNVVGTIEGESDYEVA
VAAHMDEIGFMVRHVNDEGFLQLDALGGWDPRVLKAQRVTVHAEDEDLTGVIGSVPPHTL
TEEQKQKEPKVEDVYVDLGLPAETVEETVSVGDLVTMEQTTVRMGNHVTGKAIDDRVCLF
AMLEAAKRIENPEVTIHFAATVQEEVGLRGAQALGVDLDPDLALGLDTTVANDVPGFDPA
DHVTKLGAGAGIKLKDSSAIANPKVHRRLRAVAEDDDIPYQMELLPAGGTDTGGFQNSYG
AKPVGAISMPTRYLHTVTESVHEDDVVAYIDLLTAFLESETGEFDYTL
Download sequence
Identical sequences D4GUF7 L5NGN0 L9UNM1 M0I675
WP_004044110.1.102041 WP_004044110.1.58052 WP_004044110.1.66890 WP_004044110.1.84848 gi|292654989|ref|YP_003534886.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]