SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292655254|ref|YP_003535151.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292655254|ref|YP_003535151.1|
Domain Number 1 Region: 25-170,274-363
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.49e-35
Family Bacterial dinuclear zinc exopeptidases 0.015
Further Details:      
 
Domain Number 2 Region: 162-258
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.48e-19
Family Bacterial exopeptidase dimerisation domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292655254|ref|YP_003535151.1|
Sequence length 365
Comment Peptidase M20-M25-M40 superfamily protein [Haloferax volcanii DS2]
Sequence
MSGDADGFDPVAFLERAVPVASNDDVGEMRDLLVETLEAEGVDPTVDDAGNTVASKGAAE
PATHLVLNTHIDTVSPHVPYDRDEGVIHGRGSCDAKGPLAALLSAFFAADPGPDARVTLA
ITPDEELLSTGAAQLDLDGDRYIVGEPTGLDVCTAAKGRFEGTVSLSGVAAHAAEPQSGV
NAVDALAPVLDALRSFDDDREAHPDLGPATLTPTMVDGGANSNQVPADCRLVVDRRSVPP
ETAEGFREELESTLRAAVPDDVGVDFALTERPTPFLEAFATDPDHELVTSLAAASRDAGG
RADVRPFTAATEASYFSPAPVAVFGPGDLADDEGAVAHADREYVRTDDVRTAAAALRAAV
AALTA
Download sequence
Identical sequences D4GW18 L9US49
gi|292655254|ref|YP_003535151.1| WP_004043842.1.66890 WP_004043842.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]