SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292655336|ref|YP_003535233.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|292655336|ref|YP_003535233.1|
Domain Number - Region: 81-113
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0471
Family Transglutaminase, two C-terminal domains 0.016
Further Details:      
 
Domain Number - Region: 7-36
Classification Level Classification E-value
Superfamily TTHA0068-like 0.0523
Family TTHA0068-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292655336|ref|YP_003535233.1|
Sequence length 152
Comment hypothetical protein HVO_1182 [Haloferax volcanii DS2]
Sequence
MTSFADVRERFWRESIDFTETKTFLLGLLQAGIATIEFALIFVVVAGTRLVPLSAVNTRP
SSVVVAVSLGLVPGFVLGAGLPLLVQYSEYVNRLNDNKAFRAVGPVVTFGTYFCLFFYHP
VTSVLYAVAYLLGRIAVLVGIFGGSQLKSAIA
Download sequence
Identical sequences D4GWT6 L9UTV1
gi|292655336|ref|YP_003535233.1| WP_004043759.1.66890 WP_004043759.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]