SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292655477|ref|YP_003535374.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292655477|ref|YP_003535374.1|
Domain Number 1 Region: 21-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-20
Family GHMP Kinase, N-terminal domain 0.0029
Further Details:      
 
Weak hits

Sequence:  gi|292655477|ref|YP_003535374.1|
Domain Number - Region: 241-271
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00791
Family Homoserine kinase 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292655477|ref|YP_003535374.1|
Sequence length 289
Comment shikimate kinase [Haloferax volcanii DS2]
Sequence
MHGRATALGAGTVLNALATATGSAFAIDAETTASVELDDSGEVRGSIAEAPDADAHLVER
CVELAIEAFGDGEGGTVETESDLPMAAGLKSSSAAANATVLATLSALGRSVGPGPDADIS
RLDACRMGVRAAREVGVTATGAFDDAAASMVGGVVVTDNTEDGLIARDEVDWDVLVWTPP
ERAYSADADVSRCENVAPMADLVADLALEGRYAEAMTVNGLAFSAALDFPTDPAVEAMPI
ADGVSLSGTGPSVVAVGDRTDLERVKELWDAREGETRLTTTRTDGARIQ
Download sequence
Identical sequences D4GXI3 L9USW2
WP_004043615.1.66890 WP_004043615.1.84848 gi|292655477|ref|YP_003535374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]