SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292655549|ref|YP_003535446.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292655549|ref|YP_003535446.1|
Domain Number 1 Region: 2-43,84-229,328-415
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.18e-53
Family Bacterial dinuclear zinc exopeptidases 0.00024
Further Details:      
 
Domain Number 2 Region: 214-322
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 5.23e-24
Family Bacterial exopeptidase dimerisation domain 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|292655549|ref|YP_003535446.1|
Domain Number - Region: 54-86
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0229
Family BC1024-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292655549|ref|YP_003535446.1|
Sequence length 421
Comment indole-3-acetyl-L-aspartic acid hydrolase [Haloferax volcanii DS2]
Sequence
MDDLVSLRRDLHRHPEPAWCEFYTTARLVDELETRDLDALYVGPEILDADERMAVPDDAE
LDAWVERAREAGAREDVLDRLAGGYTGAVAVVERGEGPTVGLRVDIDALPIPESEADDHL
PAAEGFRSENEGFMHACGHDAHATIGLGVLDAVIDSDFEGTFKLFFQPSEEQVAGGKAVA
EGGHLDDVDYLLALHVGLDHPTGEVVCGIDGFLAVSHFRAEFTGAPAHAGAKPEEGKNAN
LGAAAATQNLYGISRHSDGATRVNVGLMGGGTATNIVAEEAFIEGEVRGATTELMEYMED
RAHTVIESSAAMHDCEVEINVEGKAPSARSDDALAAIVGGVSEGVEGVTSILDRDDLGGS
EDATYLMQHVQDRGGLAAYVGVGTDHPGGHHTRTFDVDEETIRIAVDVLAESVDRIATER
P
Download sequence
Identical sequences L9USS8
gi|292655549|ref|YP_003535446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]