SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292655913|ref|YP_003535810.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|292655913|ref|YP_003535810.1|
Domain Number - Region: 20-114
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 0.000753
Family Bacterial dinuclear zinc exopeptidases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292655913|ref|YP_003535810.1|
Sequence length 194
Comment hypothetical protein HVO_1772 [Haloferax volcanii DS2]
Sequence
MFDKIQQAYDILSRPDADGELVRDALETYGLETEVTTISTDEGATDFVKTVVPGRDPDAP
TLGVVGRLGGVAARPAELGPVSDADGAIVALAVALHLGEMRERGDVLAGDVRIATHVCPD
APVVGVATTSVSPVPGCGTGANYLTDLLDATGFVVETAKDFTRGRASFYDEAEYDRLTSL
YGSMGRLQTLGEGV
Download sequence
Identical sequences D4GS97 L9VFZ8
gi|292655913|ref|YP_003535810.1| WP_004041654.1.66890 WP_004041654.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]