SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292655923|ref|YP_003535820.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292655923|ref|YP_003535820.1|
Domain Number 1 Region: 4-199,329-411
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.14e-48
Family Bacterial dinuclear zinc exopeptidases 0.0062
Further Details:      
 
Domain Number 2 Region: 200-307
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.0000000785
Family Bacterial exopeptidase dimerisation domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292655923|ref|YP_003535820.1|
Sequence length 414
Comment acetylornithine deacetylase [Haloferax volcanii DS2]
Sequence
MDLRDFVDTLLRFESVARAEAPAQQWVKNRLHDFGFDTHEWTADPARLAEHPSFPDDPDD
IDAANRPSVAGVVEFGDPDAGRTLVLNGHVDVVPADRELWTHDPFVPDWDDDAGTVSARG
AADMKAGLAACVFAALDLRDAVEAGRLDLDGRVVVESVVDEEEGGIGAAAAALDTPYPFE
RDAALVAEPTRLKPVVATEGSVMKRFRLTGRTAHAASRWRGVDVIEKFEAIRRAFFDLES
ERTDAVTHPLFDYPIPWPVCVGRVEAGSWASSVAGTLTAEWRLGVAPGETVAAVESAFEE
RLARVVADDEWLSAHPPVFERFSVQFEPAEIDADEPVVESLRAALRADGRDDDPVGATYG
ADSRHYVEAGIPTVLFGPGDIDQAHFPDETVEWDEVEVAREVIRETATRFLQSR
Download sequence
Identical sequences D4GSA7 L9VDX8
WP_004041663.1.66890 WP_004041663.1.84848 gi|292655923|ref|YP_003535820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]