SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292656194|ref|YP_003536091.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656194|ref|YP_003536091.1|
Domain Number 1 Region: 158-254
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000654
Family Transglutaminase, two C-terminal domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292656194|ref|YP_003536091.1|
Sequence length 402
Comment hypothetical protein HVO_2066 [Haloferax volcanii DS2]
Sequence
MTAKIDRETGGIVGLVMLLCLLTVGSVVGAAAAAPAHTAVTGVSVSEEDPETGDRIIITP
TISHSGSGSGSFEVTEVTVEDSSGTKHSEANQIGVLGAGDTAEVPVSARFDTAGDKRLTV
HVRGRYYDSDGATSEIVHLKRPVFVTVSEPSTSTTVPPRVHIETHNAVAETDTTVTVKVS
NGDDEALTDLSLRLDSVDGEMQSRTAITPVLAAENSTTYDFTVEPSEAGETALKATLRYN
DGESVEAFDTVQVEPLRDDVSVYATAFEENDTVSVRYRVTNHGNAPIDDVVISGVSNESL
LPTTSLQSVDAATSKTVVVDVNERPSSTATVAATYDIGETTGQATQSVQFDSSAASTGTN
ALTVNLGSADPSNTSTFLLSGFFGGLVVTALLFTGRRWVRDD
Download sequence
Identical sequences D4GU79
gi|292656194|ref|YP_003536091.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]