SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292656254|ref|YP_003536151.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656254|ref|YP_003536151.1|
Domain Number 1 Region: 9-48,86-233,332-419
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.5e-56
Family Bacterial dinuclear zinc exopeptidases 0.00037
Further Details:      
 
Domain Number 2 Region: 221-324
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.83e-21
Family Bacterial exopeptidase dimerisation domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292656254|ref|YP_003536151.1|
Sequence length 420
Comment indole-3-acetyl-L-aspartic acid hydrolase [Haloferax volcanii DS2]
Sequence
MAYASTLSLRELRQDLHAHPESGWKEFRTTALIAAALDEREFTLHLGPDAVAEDERLGVP
DDDAVAAAVERAREEDAPEAYLDRMGDITGLVAEKRFGNGPTVGVRVDMDALERTESSDE
KHRPAKLGFASTHPNEMHACGHDGHTAIGLGIARALDDDGGFDGTLRLFFQPAEEGGRGG
KPMSETDLLADIDYFLALHLGLGNPTGTVIAAYENPLSNAKLDVTFEGAPSHAGNAPNEG
RNALHAATAAVQNLYGIPRHADGTTRINVGKFESPNPQNIIAEEARLRVEVRGGTADLNE
YMLDKARRVLDHAAGMHDVSVETGLYGKTATFTADDEMIEAVLASAADLDDVTETVPRLD
IGGSEDASYLIRRVQEHGGKATYVGIGASNEFGHHTSRFDIDEDALDIGVDVVCQTIRAL
Download sequence
Identical sequences D4GUS4 L9V8Z9
WP_004042011.1.66890 WP_004042011.1.84848 gi|292656254|ref|YP_003536151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]