SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292656747|ref|YP_003536644.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656747|ref|YP_003536644.1|
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000334
Family GHMP Kinase, N-terminal domain 0.005
Further Details:      
 
Weak hits

Sequence:  gi|292656747|ref|YP_003536644.1|
Domain Number - Region: 220-305
Classification Level Classification E-value
Superfamily Bacterial luciferase-like 0.0228
Family Ssud-like monoxygenases 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292656747|ref|YP_003536644.1|
Sequence length 320
Comment beta-ribofuranosylaminobenzene 5-phosphate synthase [Haloferax volcanii DS2]
Sequence
MVRVSTGARIHFGFLNLSLARDRLYGGVGVALDEPRVVVAAEPASEVRCRHPAAREYAEQ
AVELLGVEGVDVSVERTLPRHAGLGSGTQLALAVLRSVAAATDREADVRRLAPEMGRGGR
SGVGVATFEAGGAVLDAGHPTARFTTDRPEDGSWSVPTVAARHEVPDRWRFLLVVPDADP
GRNGAAEESSMRSVVERADAQTGDRIAGIVTRRLLPALAEGSAERFGEAVESVGRLNGTW
YADEQGGVYRPPVGALVSSLSESPVVYGAGQSSWGPTVYGVTDADHVDEAVEAGRAALSD
ADIEGTVSVARGRNRGASVE
Download sequence
Identical sequences D4GUI0 L9V6F3
gi|292656747|ref|YP_003536644.1| WP_004042739.1.66890 WP_004042739.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]