SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|292656877|ref|YP_003536774.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656877|ref|YP_003536774.1|
Domain Number 1 Region: 5-83,172-338
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.54e-59
Family Bacterial dinuclear zinc exopeptidases 0.00013
Further Details:      
 
Domain Number 2 Region: 71-177
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 3.82e-21
Family Aminopeptidase/glucanase lid domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|292656877|ref|YP_003536774.1|
Sequence length 354
Comment TET aminopeptidase-like protein [Haloferax volcanii DS2]
Sequence
MDDDRRAFLEDLLTTPSPSGYEVAGQRVWVDYVSQFADDVTVDDYGNAVAVHEGTGEGPE
IAFTGHADQIGYIVRDIDDDGFVRIGPIGGADRTVSKGQHVTVHGDDGDVAGVIGQTAIH
LRDVGSEEYDDLEEQFVDIGATSKGDAKDHVEVGDPVTVEARVRDLAGDRVAANGMDNRV
GTWSAAEGLRAAVEADVDATVYAVSTVQEEVGVQGAKMVGYDLDPDAMVAVDVTHATDNP
DVPGKRKGPVELGEGPVVSRGSANHPNVVALARDAAGEADMGVQLQAAGIRTGTDADAFY
TSRSGIPSLNIGIPNRYMHTPVEVVSTSDLDDVAELLGSMAALAGDVESFGVEL
Download sequence
Identical sequences D4GWT1 L9V5T9
gi|292656877|ref|YP_003536774.1| WP_004043006.1.66890 WP_004043006.1.84848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]