SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292656927|ref|YP_003536824.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656927|ref|YP_003536824.1|
Domain Number 1 Region: 27-320
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-65
Family AstE/AspA-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|292656927|ref|YP_003536824.1|
Sequence length 341
Comment hypothetical protein HVO_2812 [Haloferax volcanii DS2]
Sequence
MADNEAFTYNGGKVEPGETQDIRYGISETYLGDPVRIPVTIINGEPPGPTVFLSAAAHGD
ELNGIEVVREVAYEWDLADLAGTLVCMPVMNVPAFLAQQRYLPIYDRDLNRSFPGSETST
GAKRMAHRIYQNFIAPCDLGIDFHTSTRGRTNMLHVRADMSDPAVARLANAFGSHVIIDS
SGSSGMLRTESSANGTPAITVEMGEAHRFQRELIDEALAGVESVFAEYGLRGTSTVNWPG
WRTVISDENEKTWLRADAGGIVDMHHDRGALVHEGDRICTITNPFKDDNVTVVAPFTGLL
VGVLENPVVYPGNPLCHLVELKDKVRRVVEREQSGSPETTR
Download sequence
Identical sequences D4GX45 L9V5Q3
WP_004043054.1.66890 WP_004043054.1.84848 gi|292656927|ref|YP_003536824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]