SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292656966|ref|YP_003536863.1| from Haloferax volcanii DS2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292656966|ref|YP_003536863.1|
Domain Number 1 Region: 5-183,211-273
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.22e-33
Family AstE/AspA-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292656966|ref|YP_003536863.1|
Sequence length 288
Comment hypothetical protein HVO_2852 [Haloferax volcanii DS2]
Sequence
MRIYELGDGTPEVSVVGSIHGDEPCGARAIERFVAEDPDVERPVKLIVANEEALAADERY
LDDDLNRAFPGDPNAESHERRLAHDLGREVRGTTAFSIHSTQSYAEPFAIVDAVDAISRS
ILPRLPVDVAVETNHFAEGRLIEHAHTIEVEAGLQKSDEAADNAYWLIRAFLTATNVLPA
PAVASDGGREGGAPDDAASQTEDDRLKLGIPEENSLDVFRLLERLPKPPADQYEVHATNF
EPVVAGETFARADAEQFVADRDFYPILLSAYGYADIFGYAGEKVGTLP
Download sequence
Identical sequences D4GXD7 L9UJC8
WP_004044670.1.66890 WP_004044670.1.84848 gi|292656966|ref|YP_003536863.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]