SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294495289|ref|YP_003541782.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495289|ref|YP_003541782.1|
Domain Number 1 Region: 286-572
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 9.16e-142
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000338
Further Details:      
 
Domain Number 2 Region: 3-285
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.71e-140
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495289|ref|YP_003541782.1|
Sequence length 573
Comment methyl-coenzyme M reductase, subunit alpha [Methanohalophilus mahii DSM 5219]
Sequence
MADDRKRMFQKDLEVKFTKEHGTNKMEGGDITDMRIPYYRLGVDQNPRKLEMKKVGKDIA
EKRGLAGYNPMMHCGGIPLGQRALTPSFISGNDDMMVENDDLHYVNNAAMQQMWDDIRRT
CIVGMDMAHETLEKRLSIEVTPETINHYLEVLNHALPGGAVVQEHMVESHPALVDDCYVK
IFTGDDELADEIDDQFLIDIDKQFPAEQAEQLKASIGNTTWQAAHIPTIVSRTTDGGQTT
RWTAMQIGMSYIAAYGMCAGEAAVADLSYAAKHAGVVNMGDMLPARRARAPNEPGGVTFG
NLSDIVQTSRVNPDDPANVTLEVVGAGCMLYDQIWLGSYMSGGVGFTQYSTAAYTNNILD
DNLYYDVEYINDKYDGAAEKGIDNKVAPSMDVIKDIATESTLYGLENYEKYPVALEDHFG
GSQRATVLSAAAGSAGSLATGNANAGLSAWYLCMYLHKEGHGRLGFFGFDLQDQCGATNT
FSYQSDEGLPHELRGPNYPNYAMNVGHQGGYAAIAAGAHAGRGDAYALNPLIKVCFADEM
LPFDFSQPRKEFGRGALREFEPAGERSLIIPAK
Download sequence
Identical sequences D5EAD6
gi|294495289|ref|YP_003541782.1| WP_013037080.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]