SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294495336|ref|YP_003541829.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495336|ref|YP_003541829.1|
Domain Number 1 Region: 5-123
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-43
Family BPHL domain 0.0000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294495336|ref|YP_003541829.1|
Sequence length 124
Comment hypothetical protein Mmah_0659 [Methanohalophilus mahii DSM 5219]
Sequence
MGLSGIFGNAGVVEPDKLESDYGQFMCDGETIEIGFVVIRDTFIFTNKRLVIVDIQGMTG
KKRSYLSIPYGKITKYSIETSGHFDLDAELNIWVGNDPQPIEKSFNKKVDIYDLQKILST
HVLG
Download sequence
Identical sequences D5EAI3
WP_013037127.1.50250 gi|294495336|ref|YP_003541829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]