SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294495906|ref|YP_003542399.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294495906|ref|YP_003542399.1|
Domain Number 1 Region: 775-929
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.37e-34
Family Histidine kinase 0.00022
Further Details:      
 
Domain Number 2 Region: 444-553
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.66e-18
Family Heme-binding PAS domain 0.046
Further Details:      
 
Domain Number 3 Region: 139-251
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000436
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.025
Further Details:      
 
Domain Number 4 Region: 700-778
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000667
Family Homodimeric domain of signal transducing histidine kinase 0.0068
Further Details:      
 
Domain Number 5 Region: 588-697
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000177
Family Heme-binding PAS domain 0.067
Further Details:      
 
Domain Number 6 Region: 256-420
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000024
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294495906|ref|YP_003542399.1|
Sequence length 933
Comment PAS/PAC sensor signal transduction histidine kinase [Methanohalophilus mahii DSM 5219]
Sequence
MVLMGTGVHNSLFDNMFYEILAKDISFDQKMEELTKVLPQILRYPEKASARIILGPYSYM
SPDFKQGKHQISSSSISKNEEEGHELCIELFYNNLSLKNNYSPFNSDEKQKLDFIAKILS
IFIDKEIELKRARYDYDFLLGSTNEIPYSLNSEGNIVYISPKVQEYGLHPDQMIFRPFTD
YIYADDMEEWLNIFNNITSVDHLPLKAQIRIQNDNQELHWFQNHIDPIYDEMGNFMGING
IVREINRRKEAELHSQEQSEAFRFLARACNQFVDPFFEDIDLLIEPILEKIMGILDADSI
FIYELNHSGSNMHLTHYTSASHVKERCELAMDKLNSLSTAQFPTLIEKFQKNEIYSVNSI
GDIPDSEKYLKGLLTTLDFESAQIMPVHVENQLVGFIGVVSATKNKHWPPYSDDLLRILF
DSIFNAKERGKTYMMLDNTMHLYRSLFDRSNDAIFIHSSEGAIIDANRSACKIIGCSHSD
MLSMKIADLYPQESRYVAQLKSAVQSTFNEGSTRFESKMKHMNNSIIDVEISSSMLDKEN
NIMLSIVRDITERKKYELELESYRKNLEELVDQRTSELQTANSWVSALYDNAPIGIGVLN
KDLELIDLNKGMTELTGIPREKIVGKSLFSIFTEGSSNYIDKDLGVSILEKQFSTELHWL
CNKKHICIQFNSQPLGLKDSPKKVIFTAQDITRRKQAEIALKDYAGQLEKSNEMKDLFTD
IMRHDLLNPANIVKGFTDILIKNEKEEKKIHFLSRIRDNTERLIDMIENTAYLSKLESTE
TLELQKMDLGRVLTSCISEMTPLAENENMGITYDLQQPYPVQANPVIKEVFINLLSNAIK
YSPPESSIHVGVQEKDDSFKVMIKDKGFGIADDDKPYIFNRFSRAQKGSIKGTGLGLAIV
KRIVELHGGSVGVEDNPGGKGSVFWVYVKKYSE
Download sequence
Identical sequences D5EC53
gi|294495906|ref|YP_003542399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]