SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294496045|ref|YP_003542538.1| from Methanohalophilus mahii DSM 5219

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294496045|ref|YP_003542538.1|
Domain Number 1 Region: 558-726
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-48
Family Histidine kinase 0.00075
Further Details:      
 
Domain Number 2 Region: 348-472
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-27
Family Heme-binding PAS domain 0.066
Further Details:      
 
Domain Number 3 Region: 485-569
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.87e-22
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 
Domain Number 4 Region: 54-175
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.23e-20
Family PYP-like 0.065
Further Details:      
 
Domain Number 5 Region: 208-362
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000162
Family GAF domain 0.059
Further Details:      
 
Weak hits

Sequence:  gi|294496045|ref|YP_003542538.1|
Domain Number - Region: 15-67
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000712
Family Heme-binding PAS domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294496045|ref|YP_003542538.1|
Sequence length 729
Comment PAS/PAC sensor signal transduction histidine kinase [Methanohalophilus mahii DSM 5219]
Sequence
MRAAVKAALSRKPGYYEGKYLTAISGKLISIKADYNPNISEDGILLGGIGIFEDISDRMK
AEEAMRESEKKYRLIFENSPLGIFHFDENGVITHCNENIMHILDVTRDQIIGFNMLKDLK
DKKMYEAVKAVFQRRSGHYEGKYHSTTGKKATPIKADYSPYISEDGELLGGVGIVEDISD
RMKAEEALHLDESRLETLVKLNQMTEASLEEIIDFARAEGVRLTESKIGYLAFVDEDIGT
IQLKSWSDTPMNRCKIKNKKVEYKIEDVGLWGESIRQRRPFINNDYKKPHPRKSGYPKDH
VELIRHMDVPIFEQGKIVALAGVGNKNENYDSSDVRQLTLLMQGMWRIVQRRKTEKELEK
SEDKFRTIFASTNDAIFVHDLKGNIMEVNKAACETTGYSRDELLRMKTKDINTGLSMEEI
PQRIKEVKEKGHAIFEATFRREDDTTIPVEISARMIEYNDKPTILVVARDITERKRAEEE
LRKYAQDLSKANEELKSLDKMKDEFLSNVSHELKTPLTSIIGYTELLNDGSLGELGEEQK
HAEETVMRNTKRLQRLVDSLLYLSRTQAGTVQYDFETLNISELTDQIIEDLQIQTEEKNL
EMIKKIEPDLPQIKGDRDKLTDMFTNIIDNSIKFTPKGGSITIFANKEDEYIHINIKDTG
IGIPKDMIDNLFQRFYQIDSSQKRKYGGTGLGLYITKTIVEAHEGEIWVESEGKGKGTEV
HIKLPVAEN
Download sequence
Identical sequences D5E6V5
WP_013037835.1.50250 gi|294496045|ref|YP_003542538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]