SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295680564|ref|YP_003609138.1| from Burkholderia sp. CCGE1002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295680564|ref|YP_003609138.1|
Domain Number 1 Region: 173-294
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.09e-21
Family Flavohemoglobin, C-terminal domain 0.055
Further Details:      
 
Domain Number 2 Region: 99-170
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 0.0000000000133
Family Ferredoxin reductase FAD-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295680564|ref|YP_003609138.1|
Sequence length 297
Comment oxidoreductase FAD/NAD(P)-binding domain-containing protein [Burkholderia sp. CCGE1002]
Sequence
MIVLALIRQFPYRWFAKTHNWLAVLYLPLAFHTVVLLRFGYWRAPVGVVVVVLLAAGIVS
VVRVLGGHVGRQCKVEGRIASLTWYPELRVLQTAIDLRPGWPGHASGQFAFVTSDRSEGA
HPYTIASAWNPRVPRVVFLTKELGDHTSRLKDRLREGMPVTVEGPYGCFTFADQRAHQIW
IGAGIGITPFVARMKELAQHRDRRHRIDLFHSTADFSQKAIDQLVADAKAAEVQLHLLVD
AKHGRLNGERVRTAIPDWASASVWFCGPPAFGEAVRDDLVAHGLDSADFHQELFQLR
Download sequence
Identical sequences D5WK81
WP_013093418.1.39461 gi|295680564|ref|YP_003609138.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]