SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295681168|ref|YP_003609742.1| from Burkholderia sp. CCGE1002

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295681168|ref|YP_003609742.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Globin-like 1.13e-41
Family Globins 0.000000722
Further Details:      
 
Domain Number 2 Region: 264-399
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 1.7e-36
Family Flavohemoglobin, C-terminal domain 0.00000428
Further Details:      
 
Domain Number 3 Region: 151-261
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.21e-29
Family Ferredoxin reductase FAD-binding domain-like 0.0000042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295681168|ref|YP_003609742.1|
Sequence length 404
Comment oxidoreductase FAD/NAD(P)-binding domain-containing protein [Burkholderia sp. CCGE1002]
Sequence
MLTQKTKDIVKATAPVLAAHGYTIIQRFYRRLFEAHPELKNVFNMAHQEQGQQQEALARA
VYAYAENIEDPGSLAAVLRNIANKHASLDVKAEHYPIVGEHLLGAIKDVLGDAATDDIIS
AWAQAYGNLADVLMGMESELRETRAAQLGGWTGWRTFVVEEKRPESSVITSFILEPKDGQ
PVANFEPGQYIGIAVDVPALGLQQIRQYSLSDVPNGHSYRISVKRESGEAGRPAGYVSSL
LHDHVKVGDEVKLAAPYGTFYIDVHAKTPIVLISGGVGLTPMVSMLKRAIQDPQRRVVFI
HGARNGAVHAMRDRLQQTAATQPNFRAIVFYDAPLDTDVQGRDYDNAGFIDLSKLRDEIL
LPDADYYICGPVPFMRLQHDALKNMDIHESKIHYEVFGPDLFAE
Download sequence
Identical sequences D5WLY5
WP_013094018.1.39461 gi|295681168|ref|YP_003609742.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]