SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|292491583|ref|YP_003527022.1| from Nitrosococcus halophilus Nc4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|292491583|ref|YP_003527022.1|
Domain Number 1 Region: 569-796
Classification Level Classification E-value
Superfamily C-type lectin-like 1.06e-54
Family Sulfatase-modifying factor-like 0.00042
Further Details:      
 
Domain Number 2 Region: 109-342
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000446
Family ABC transporter ATPase domain-like 0.068
Further Details:      
 
Weak hits

Sequence:  gi|292491583|ref|YP_003527022.1|
Domain Number - Region: 17-74
Classification Level Classification E-value
Superfamily DEATH domain 0.0133
Family DEATH domain, DD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|292491583|ref|YP_003527022.1|
Sequence length 799
Comment hypothetical protein Nhal_1492 [Nitrosococcus halophilus Nc 4]
Sequence
MMVYSGKQKIAFSKRLQRDWKDLADYFDIPPQEQAAFDKGHEPRDIWVWLEERERLQELP
EALHYIDREDIIAEVLTPPTPPPPPATHTHQKGSPFPGLRAFTTKEARLFFGRTAETNEL
LNKIKQQALVAVIGASGSGKSSLVAAGGLPRLRELPGGESWQKIRFTPGGLGDDPFLPLA
AKLEPYLETHDLSGRTIAEKLRATGDLAALVRPLFEERPATTKLLFFIDQFEELFTLTEP
KHHKRFIAMLEKAAQADRLRLVLALRADFFHHCIDYPRFDKWLRAGFFSLAPPDLLALME
MITGPAAVAGLSFEEGLSGRILRDTGNEPGALALMAFALAELYKACQPGTTLTHTAYDSF
GGIKGAIGKRAEDAYAKLNKDAQNALAGIFKELVEIDSERGIPTRRRSSLTHFKTTPAAC
TSIEQFAKARLLNCGDPEEDRDVVEVAHESLLTRWPRLKKWIEDRFADFWRRKQLQQAAL
EWEVQERKEAYRWSHERVVEACGMLKRLDYQPTPLEQEFLGPIHPQHMLAEIQDPDTSHE
CRALIGVRLALLGDPDPRKGVGLREDGLPDIEWRQVPPGEVILEVEGDEPAFPFPVAPFY
IARYPVTWQQYQAFLEAADGYSNPERWQGLLDQHSAPGRPFQAYDNHPADNVSWLDAVAF
CRWLSARLGYEIRLPTQWEWQQAATGGDPANMYPWGVEENPAYANTYESGLSRSTAVGMY
PLGASPVGALDMGGNLWEWCLNEYRHPERTQLSGDESRVVRGGSWGNDLGLARSAFRYHY
LPNNRFILIGFRVVCSSPI
Download sequence
Identical sequences D5C178
gi|292491583|ref|YP_003527022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]