SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928658|ref|YP_003421180.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928658|ref|YP_003421180.1|
Domain Number 1 Region: 23-207
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.66e-73
Family HD domain 0.00000149
Further Details:      
 
Domain Number 2 Region: 196-412
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.62e-60
Family RelA/SpoT domain 0.000021
Further Details:      
 
Domain Number 3 Region: 395-467
Classification Level Classification E-value
Superfamily TGS-like 1.64e-19
Family TGS domain 0.042
Further Details:      
 
Domain Number 4 Region: 663-741
Classification Level Classification E-value
Superfamily ACT-like 0.00000000000371
Family AF1403 N-terminal domain-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284928658|ref|YP_003421180.1|
Sequence length 745
Comment (p)ppGpp synthetase, RelA/SpoT family [cyanobacterium UCYN-A]
Sequence
MNTVTSLNNKPLDFTLPDWLNQCLISRKSDIYNQNQDLICHAFDFAYQLHKGQYRKSGEP
YIVHPVTVAGILRDLGGDKSMIAAGFLHDVVEDTDITADNIEEMFGQEVRLLVEGVTKLS
KFNFSNKTEQQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLDALKPEKQKRIALETKE
IFSPLANRLGIWRVKWELEDLSFKYLETNAYWEIQGLVAEKRIDREARIENVKNILQKRL
NSIGIQVLELQGRSKHLYGIYYKMHSQNKGFHEIYDLAALRIIVQNKEECYRALAVVHDT
FKPMPGRFKDYIGLPKPNRYQSLHTTVVGFNGRPLEIQIRTLEMHHIAEYGIAAHWKYKE
TGVSHYTQLSQEDEKFTWLRQLLDWQKDLKDAQEYVDNLKDNLFDDDVYVFTPDGDVIAL
ARGATTVDFAYRIHTEVGNHMKGARINGKWSVFGQPLHNGDIVEIITQKNCHPSLNWLNI
VVTPTARNRIRQWYKRSCREENMIRGRDMLEKELGKNGFEALLKSEPMKTVVERCNYHSV
DDLLSGLGYGGITLNQVVNRVREITVKTQQKAAESHEINIPAPPSSLGLKKPNRSPILGV
EGLLYHIAGCCRPLPGEPIIGVVTRGDRGISIHTQNCSNIENIPGERFIPVRWNRVDEKG
CTITYPVDVQIEVIDRVGVLKDILLRVSNHNINVCNASVKTVQNKPAIVNLRIEIRDRQQ
LEYLTNSICNMSDVLNIQRVNRVEF
Download sequence
Identical sequences D3EMX2
gi|284928658|ref|YP_003421180.1| WP_012953487.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]