SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928664|ref|YP_003421186.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928664|ref|YP_003421186.1|
Domain Number 1 Region: 13-104
Classification Level Classification E-value
Superfamily Translation proteins 1.09e-17
Family RimM N-terminal domain-like 0.0084
Further Details:      
 
Domain Number 2 Region: 110-188
Classification Level Classification E-value
Superfamily PRC-barrel domain 0.000000000251
Family RimM C-terminal domain-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928664|ref|YP_003421186.1|
Sequence length 195
Comment 16S rRNA processing protein RimM [cyanobacterium UCYN-A]
Sequence
MQNNYMQQNIDNMLKIGTIVGPRGLKGELKVLSSTDFPERFEISEEHWISDPNKSTLQSV
KLISSRYVMEKNIYIVRLQGIETRNQAELLRNYKLFISNHSIPELKKDEYHISQLINLEV
YHQKTKKLIGIVTDVFTTGHDLLEIELENPSLPESDKKQKFLVPFVYEIVPIVDLVNRRI
ELNPPKGLLDLSIVK
Download sequence
Identical sequences D3EMX8
gi|284928664|ref|YP_003421186.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]