SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928676|ref|YP_003421198.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928676|ref|YP_003421198.1|
Domain Number 1 Region: 245-305
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000051
Family TonB 0.043
Further Details:      
 
Weak hits

Sequence:  gi|284928676|ref|YP_003421198.1|
Domain Number - Region: 131-186
Classification Level Classification E-value
Superfamily t-snare proteins 0.0738
Family t-snare proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928676|ref|YP_003421198.1|
Sequence length 348
Comment hypothetical protein UCYN_00850 [cyanobacterium UCYN-A]
Sequence
MMQSIFSKAKSKQVFNSHVFSIFTSISVHILAFSLANSNLTNILFSKSQKVHKRSESIQI
VELESMEELETPLQPLKSLNVKDSSIHSNNSTISNTSSSNITKTSSTPLKKDFSKNENNT
LIKDELKIKPNNVSVKNKLEKNHIKEIESLEKKLPDDKPINKNDKDNIDLKTQLVQSTNK
PPSFEKHKISKVRQNQITQKLLEETLNGAEKLIYNDVGTQRAEARQKDIEWMQRTGIALK
LNQMITIEGSYPKSACNLNLQGSSVYNIFVNKNGKLNGSPFMTQSSGYGILNDQGLEDIK
LYNFSQSTRVRVIFQPDYDKCPNLVPIQNSKKHSTFNKTIERSNNIEN
Download sequence
Identical sequences D3EMZ0
gi|284928676|ref|YP_003421198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]