SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928719|ref|YP_003421241.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928719|ref|YP_003421241.1|
Domain Number 1 Region: 8-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.64e-35
Family Pyruvate oxidase and decarboxylase Pyr module 0.0055
Further Details:      
 
Domain Number 2 Region: 406-555
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.72e-17
Family Pyruvate oxidase and decarboxylase PP module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928719|ref|YP_003421241.1|
Sequence length 586
Comment 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [cyanobacterium UCYN-A]
Sequence
MIKNLDFRNINTLWSSIIAETLSNLGLKTAIICPGSRSTPLTVAFANHPKIETIPILDER
SASFFALGIAKRSRLPVVLICTSGTAGANFYPAVIEARESKTALIILTADRPPELRDCHA
GQAIDQVKLYGSYCNWYTELSLPLIEIKLLSYLRQTIISSWNKSFLPNKGVVHINCPFRE
PLAPFTQPEIELLSFKKYFKDFFLDINEDSRVSSSNYCKFDIFNYLNKWRSIKKGIIIAG
VNNSTNPSLYCKNIAFISRFLNYPILAEALSPLRNFANKNPNLINTYDVILCNPKLKESL
KPDIVIQFGQFPTSKRLRKWLEQTQARYWLIDSSSDNFDPLHNHSFSIYSSVENLDLRNI
KNTMSTKSNSEYLKRWKIINDNVNKNIQSTFTGIDLMLQAKLPFILSTILPLQTNIFIAN
SMSVRYAESFWFPNNKELIPYFNRGANGIEGTLSSALGMAQNSSNNILVTGDLALLHDTN
GFLVSKKFKGHLTIILINNNGGGIFEMLPISKDKLLFEDYFATPQNIDFAKLCNTYDIQH
INIQDWRHLQELLNPLPTFGVRVLELTIKREEDASWFQNNISKFTD
Download sequence
Identical sequences D3EN33
gi|284928719|ref|YP_003421241.1| WP_012953548.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]