SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928819|ref|YP_003421341.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928819|ref|YP_003421341.1|
Domain Number 1 Region: 588-686,713-758
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000123
Family HD domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284928819|ref|YP_003421341.1|
Sequence length 812
Comment hypothetical protein UCYN_02360 [cyanobacterium UCYN-A]
Sequence
MKTLQSLKKNLVKLLRENYSKHFGLKKKNNFESKIIYESNWLAKLHQSKSIKKIYPPLMW
GITVISLSSVIGYRFYNQPQLSVGTLSPVKVIAPKDGNFEDRKTTEDKRKEVRTGIIPVL
KRDPRLTKELKEELKKTISEIEQLRKKINLFSSVDVVLIPLSTQKYLRKVNERDWQIIQL
VIINHNFQNIPASKPKIKQVVSQLVAYSEATSLISLKNLLEKIEQSRQLYNQTKAEASNS
QASYLSSELFTTFLNLDDYTWQTVEKILQTTLNRILLQGLHPGIPDYLLKEIINIQLEST
TSAVPKPAITKLLMRILKSQHNLTVDKEATKQRAEQAAQAVEAVIVKIKAGDIIVEAEEY
ITQEKFVLLDSFRLSRRGINWIGLSISVLIVIGTVVIFCLISQRINHSIRRRDHILICLL
SLSTPLLGIFNLGYTNLPAIGLLSSSFYGPTLAITQVILLSGLSAFAATSINWSYILAGT
AGGLLAASVAWKLRSRDELACLGGVVGIVQGSLYFIGYLIMAPAVGTIWSVILPESIIYG
LSGIAWSVMGLGISPYLERLFDLVTSIRLVELANPNCGLLKRLATETPGTFQHTLFVACL
AEAAARELDCNVELIRAGTLYHDIGKLHDPMGFIENQMGDTNKHDVIDDPWQSVKIIKKH
VSEGLVMANKYGLPKVIRDFIPEHQGTLLISYFYHQAAQEALNNGENEISEQEFRYAGPI
PQLRETGIVMLADGCEAALRSLKEATPEMALLMVQKIFKARWRDNQLKDSGIRYEELPII
AEVFVKVWQQFHHQRIVYPKSALEPTKNNKLS
Download sequence
Identical sequences D3END3
WP_012953648.1.87152 gi|284928819|ref|YP_003421341.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]