SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928900|ref|YP_003421422.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928900|ref|YP_003421422.1|
Domain Number 1 Region: 23-218,319-408
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-80
Family Bacterial dinuclear zinc exopeptidases 0.0000188
Further Details:      
 
Domain Number 2 Region: 204-315
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.01e-30
Family Bacterial exopeptidase dimerisation domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284928900|ref|YP_003421422.1|
Sequence length 410
Comment amidohydrolase [cyanobacterium UCYN-A]
Sequence
MDCCNVSSNTNITTIHKGYMLSEIKNLVEDFLPRFVEIRRNLHSYPELSGKEHQTAAYVA
NILSSYDIPVEKFIGKTGVVGHLISDSEEKSVLAIRTDMDALPMQEKTKLNFSSYNSGVM
HACGHDVHTTVGIGTAVILSMLRKQLGGNIRFLFQPAEEIAQGAKWMLQDGVMNNVDAIF
GVHVFPSLPAGSIGIKYGTLTASVDNIQVFIKGESGHGARPHEAVDAIWIASQIITVLQQ
AISRTQNPLHPLVLTIGKITGGHAPNIIADQVEMSGTMRSLHPETRAKLPQWIEGIISNV
CQAHNAKYEIDYQWGVSSVENDIHLTSILENASREAWGNDFVRILSEPSLGSEDFSSYLE
YSPGTMFRLGTGYPNKINHPLHHPLFDIDESAIATGITTLAYTAYKYWKS
Download sequence
Identical sequences D3ENL4
gi|284928900|ref|YP_003421422.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]