SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284928997|ref|YP_003421519.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284928997|ref|YP_003421519.1|
Domain Number 1 Region: 5-58,106-197,227-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 2 Region: 354-471
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 8.25e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284928997|ref|YP_003421519.1|
Sequence length 483
Comment dihydrolipoamide dehydrogenase [cyanobacterium UCYN-A]
Sequence
MNKKEFDYDLVIIGGGVGGHGAAVHAVKCGLKTALIEMRDMGGTCVNRGCIPSKALLAAA
KKVRELQNSNHLEELGIKVGELKFDKEKISNHAINLVNKIRQDLTNSLKHLKVEVIYGQG
KVINNQTINVLTDNGEQKITAENIILSPGSSPFVPPGIKIDNDTVFTSDEAVKLKELPKW
IAIIGSGYIGLEFSDIYTALGCEVTIVEALDNLIPGFDSEISKFAQRKLIESRDIETYSG
VFASKVIPGKPVVIELTNVKTKQLVDVLEVDACLVATGRIPETSNLGLNNLGIELQKGFI
PINDKMQVISNGQVVPHIWSIGDATGKMMLAHVASGQGVIAVENICGRNIEIDYRSIPAA
TFTHPEISYVGLTESAAKELSKLENFEFSSVKAYFKGNSKALAEGDADGFVKIIFRKDSG
ELLGVHIIGSHASDLIQEAANSIGQHQTIYNLALNIHTHPTLSEVLDDAYKKALVTLNKT
EKN
Download sequence
Identical sequences D3ENW1
WP_012953826.1.87152 gi|284928997|ref|YP_003421519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]