SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929040|ref|YP_003421562.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929040|ref|YP_003421562.1|
Domain Number 1 Region: 19-107,154-372
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.94e-34
Family Pancreatic carboxypeptidases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929040|ref|YP_003421562.1|
Sequence length 376
Comment putative deacylase [cyanobacterium UCYN-A]
Sequence
MKPNIEILNLFKLASGDEISIQIYKFIGQKSDKKVYIQSNLHGSEIVGNAVIHQLINFLS
TLNKSQVNGEIWLVPVCNPLGTNQRNHFFSSGRFNSYDGKDWNRIFWDYEKVLSDLEDFV
KNNLNFDYLTIQKNFLKQQKIVFSEHVKKIQSSSSAPLFEQYRYKLQSLAMDANYLIDIH
SSSNKCIDYLFSFPGTQQENAAYFKLNYGVLMDTFNGNSFDEAFLKPWLALQKEFKRLGK
EIEIDRESWTLELGSGMEMEPKSVSVGFSGIKNYLVQKEILKLYDYSLNKTKIELVPREK
IKNYYAPTGGMIQNRLSLKTQVKEGDRLYQIISFNKHGNLPEVINITAEKDGFIFDLSTN
FSVNQGEYVLSIFSLN
Download sequence
Identical sequences D3EP04
gi|284929040|ref|YP_003421562.1| WP_012953869.1.87152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]