SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929072|ref|YP_003421594.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929072|ref|YP_003421594.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily IpsF-like 7.59e-62
Family IpsF-like 0.00000786
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929072|ref|YP_003421594.1|
Sequence length 161
Comment 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [cyanobacterium UCYN-A]
Sequence
MVDIRIGNGYDIHRLVLGRPLILGGIHIPHRLGLLGHSDADVLTHSIMDAMLGALSLGDI
GHYFPPSDSQWANANSLTLLKQVNQLIRSEGWYLGNIDSTIIAEEPKIKPHIQLIKEKLS
QVLNICQNQVSIKATTNERLGPVGREKGISSYAVILLFKSL
Download sequence
Identical sequences D3EP36
WP_012953901.1.87152 gi|284929072|ref|YP_003421594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]