SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929235|ref|YP_003421757.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929235|ref|YP_003421757.1|
Domain Number 1 Region: 7-216,299-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-35
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 211-298
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.2e-17
Family D-aminoacid oxidase-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929235|ref|YP_003421757.1|
Sequence length 365
Comment glycine oxidase ThiO [cyanobacterium UCYN-A]
Sequence
MIMSTTSDVIIIGGGIIGMSIAIDLKLKGISVTVCNKNLAQSASPAAAGMLAPYAERLSG
PLLDLCLKSRCAYPDWIRKIQKLTNLDLKYENCGALAPVYNISQNSRTQCSKGQWLDGKS
IHLHQLGLGKDVKGGWLYPDDGQVDSRQLLYGLYQAARILGVNIKNEVIVHNLLKKENKV
IGVYTNKGNFKANTYILAGGAWVNNFLSLPVRPLKGQMLAVKIPKQYSLQKILYGTQVYL
VPRKNRRLIIGATSEDLGWMSGNTSKEIEKLIKKSMKLLPDVVNWPIQEFWWGYRPVTPD
KLPILGYYNYDNLIIATGHYRNGILLAPITASLIAELVTNKKNNPLLTNFSGARFKNKSF
SLQHL
Download sequence
Identical sequences D3EPH6
WP_012954063.1.87152 gi|284929235|ref|YP_003421757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]