SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929317|ref|YP_003421839.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929317|ref|YP_003421839.1|
Domain Number 1 Region: 12-341
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.77e-102
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929317|ref|YP_003421839.1|
Sequence length 343
Comment pyruvate dehydrogenase E1 component subunit alpha [cyanobacterium UCYN-A]
Sequence
MVSERILPTFDTMSIQLSKDEGLMLYEDMILGRLFEDKCAEMYYRGKMFGFVHLYNGQEA
ISTGIIKALRSGEDYIASTYRDHVHALSCGIPPREIMAELFGKETGCSKGRGGSMHLFSK
KHRFLGGYAFVAEGIPVATGAAFQNKYRHQVMGDDNADQVTACFFGDGASNNGQFYECLN
MAALWKLPIIYVVENNKWAIGMSHDRATSQPEIYKKASVFNMVGVEVDGMDVLAVRQVAK
EAVARARAGEGPTLIEALTYRFRGHSLADPDELRKLDEKKFWEQKDPIQKLSNYLINQNI
ASQTELDTIQEKVKIIIDDAVEFAENSPDPKTNELYRYVFTQD
Download sequence
Identical sequences D3EPQ8
WP_012954145.1.87152 gi|284929317|ref|YP_003421839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]