SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929412|ref|YP_003421934.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929412|ref|YP_003421934.1|
Domain Number 1 Region: 47-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000001
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929412|ref|YP_003421934.1|
Sequence length 689
Comment FAD binding protein [cyanobacterium UCYN-A]
Sequence
MGKFKARELINKQLLSRKRNNELKFLGHIFTSLSLGIISLNTIFPASARTSEELISCDML
IVGAGLSGSAAAYEGLLAGKTVCLTELTDWVGGQISSQGNSAFDEGKQQRSLQHFSRGYN
VLRNNIARFYNRQNPGECWVSESCFLPSHGHQLLYKQLKKAEQSGNGTLKWFPSTVVKEI
ELSENNRLIQSAIAIQHSPTDSDLYLHKEPLSHTIKDIYSYSDSERFKKRIIRFQAKSQG
KSSTNWFVIETTETGEIIALADIPYNLGLDPLNHFNPSSPTKNRDPYCLQGFTYPFAMER
TASSQNQSKPKFYDKYKPYYGYDNDRRLAHFDLVFTYRRIWTPRKGRLVKTGPLKVNEPS
SGDISMQNWLWGNDYRPGTSQDNLVYTRQQLKEKGQLEKGKWEGGLRTETLRKGEELSLG
FYYWLVAGTTDSRLGNNIKKPSLNHRLLKGLSSPMGTKHGLSKYPYIREGRRIIGRPSYD
HPNGFSVNEIDISTKDYWNNFYRTSLPRPMYQRVWSTIANLESRIMTLSNRPSYLVTRRT
HATIYPDSVGVTQYMIDFHPCMVLSPPEKSGNLERREVRVAHGSAHPAQIPLRAMIPQKI
DNLIVSGKNIATSHIAAAAYRVHGFEWSVGAAAGTLASFSLEKDILPYELVDDLPKQEPN
LQKFRQILENNGNPTTFPQAMMFSYLQNN
Download sequence
Identical sequences D3EQ03
WP_012954240.1.87152 gi|284929412|ref|YP_003421934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]