SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929626|ref|YP_003422148.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929626|ref|YP_003422148.1|
Domain Number 1 Region: 174-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.08e-112
Family Leucine aminopeptidase, C-terminal domain 0.000000281
Further Details:      
 
Domain Number 2 Region: 1-177
Classification Level Classification E-value
Superfamily Macro domain-like 1.18e-34
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284929626|ref|YP_003422148.1|
Sequence length 490
Comment leucyl aminopeptidase [cyanobacterium UCYN-A]
Sequence
MNIYGSDTSLLDWTGDTVAIGLFENEINLIGELDQLNNKTKGTLQELIDETKFEGKVGRI
IFTRLGGSASIRKILLVGLGKSEEFTLNSLRLSIASVARFSKKEHIQTLCLQFPIFNNNP
SLTAEVITEGLLLSLHQDNRFKSNSDDKLVELKTIDILGIGEQKDAISRAQIICSGVIMA
RELVNAPANYINPITFTEVAKKLANEYDLEIEILEQDECAKLGMGAFLGVAQASDLPPKF
IHLTYKSKDIAKRKIAIIGKSLTFDSGGLNLKGSSSGIEVMKMDMGGGAATLGVAKAIAQ
LKPNIEVHFICAVTENMISGCAIHPGDVLTASNGKTIEVNNTDAEGRLTLADALVFAEKL
EVDSILDIATLTGACIVALGDNISGLWSTDNNLINEIKIASEKSGEQFWQMPMEDKYFEG
LKSSIADMKNTGPRAGGSITAALFLKQFVEKTPWLHLDIAGTAWIDKENGVNNAGATGVP
VRTIVNWLTD
Download sequence
Identical sequences D3EQL7
WP_012954454.1.87152 gi|284929626|ref|YP_003422148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]