SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929676|ref|YP_003422198.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929676|ref|YP_003422198.1|
Domain Number 1 Region: 1-230,324-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-29
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 
Domain Number 2 Region: 231-320
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000549
Family D-aminoacid oxidase-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284929676|ref|YP_003422198.1|
Sequence length 374
Comment Glycine/D-amino acid oxidase [cyanobacterium UCYN-A]
Sequence
MPRIVIIGAGIIGATIAYELSLLNGIEIILVDEKFPASSSTKGALGVLRGVANYKTRGKG
WDLCKTSLKRYKTLIPELEKLTQIPIQVNSNGILLLHYVDNYLEKWGDLIEIRNSSSYFL
EVWEKSTLFQKCPQIKDERITGAIYSPQDFQVNPIQMTRALVLGASLNGVHCLFNTKIQK
ISPSFDQKFSHDLTCYTKTSKRILKADYIVISAGLGSNELVNKLQTIVKIKPVIGQGMQI
DLNAPLENTNFIPVIAGKGINIIPVNPQRYWVGSTIEFPRSNGEMLAQSKFLEQIKRELF
SICPGFKNGNITKIWTGKRPRPDGGIAPIIEKIPHHSNILLATGHYRNGILLAPATALNI
KNKILEDLSIKYNH
Download sequence
Identical sequences D3EQR7
WP_012954504.1.87152 gi|284929676|ref|YP_003422198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]