SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284929748|ref|YP_003422270.1| from cyanobacterium UCYN-A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284929748|ref|YP_003422270.1|
Domain Number 1 Region: 119-432
Classification Level Classification E-value
Superfamily DNA primase core 1.02e-91
Family DNA primase DnaG catalytic core 0.0000221
Further Details:      
 
Domain Number 2 Region: 4-101
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.87e-36
Family DNA primase zinc finger 0.000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284929748|ref|YP_003422270.1|
Sequence length 649
Comment DNA primase [cyanobacterium UCYN-A]
Sequence
MSFLRIPSDTLEEIKERANIYEVISEHVVLKKRGKNYVGLCPFHNEKTPSFSVNPDKQLF
YCFGCGAGGNAIKFLMELKKEPFHQVVLELAKQYKIPIKELESENTKTLQEKISLQDQLY
EILATSANYYEHLLHEPSGTQALDYLINKRRLKLETISKFNIGYSPEGWETLYSYLVEYK
KYSTDLLEQTGMIKRRNKGNGYYDTFRGRIMIPIKDVQGRIVAFGGRSLNNQEPKYLNSP
ETALFSKSKILFALDQSYKNIRNLDQAIVVEGYFDVISLHEAGINNTVASLGTTFSKAQL
RKLLRYTDSKQIVFNFDADNAGIKATQRMITEIESLVYSGQVQLKILNLPNGKDADEFIQ
FNQNSTEQYYELISNAPLWFSWQIQQILLNKDLKRADHFEKIVKEMIDLLSKLSDYNKRE
YYIRHCSEVLSQGDARLIPIYLKNFQLQLAKPIAKQTNNEKSGKFTKVNILLEDQLLKEA
ENNLLKVYLRYPEYRSQISKDLESKNLFFSVQEHRVIWAEILEFEDNHQYDEKIDKYQLI
YKLQETIWDSSLTEICINQILNFSELEQHEDNDIERLDLIIKASLIFLEKASLKKYCYYC
KTKYQMIDKNKDLVNFEYYLNEYIASKQKILLLQSLQSCSQLNIKDSAN
Download sequence
Identical sequences D3EQY9
WP_012954576.1.87152 gi|284929748|ref|YP_003422270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]