SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|385325942|ref|YP_005880379.1| from Mycoplasma gallisepticum str. F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385325942|ref|YP_005880379.1|
Domain Number 1 Region: 155-295
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.44e-47
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000299
Further Details:      
 
Domain Number 2 Region: 9-56
Classification Level Classification E-value
Superfamily UBA-like 1.32e-17
Family TS-N domain 0.0042
Further Details:      
 
Domain Number 3 Region: 58-146
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 0.00000000000000458
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385325942|ref|YP_005880379.1|
Sequence length 295
Comment elongation factor Ts (EF-Ts) [Mycoplasma gallisepticum str. F]
Sequence
MKNMASITELIKQLRASTQAGFMDCKKALEATNNDIDQAIKWLRENGIAKAAKKVDNVAS
EGVIKLKLADQKATILEINSQTDFVTKNDQFVAFSNELVDLVHKHEITDVAKIEQLKLAS
GSTVAETQIHLTAIIGEKISLRRVGFVKEEANSSLATYLHSNSRIGVIVKTSKTDDKEFL
KHLAMHIAASNPKFVSQNDVSADFIAKEREIAAAQAQSENKPKEFIDRIVDGRINKVLEE
VCLVNQKFLVNQEQTVQQAAQAKKVEILNFIRYEVGEGIEKQVTNFADEVKAQMK
Download sequence
Identical sequences gi|385325942|ref|YP_005880379.1| WP_014574397.1.30281 WP_014574397.1.95389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]